Protein Info for ABIE40_RS05520 in Rhizobium sp. OAE497

Annotation: HD-GYP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 PF13487: HD_5" amino acids 132 to 219 (88 residues), 38 bits, see alignment E=1.5e-13 amino acids 269 to 431 (163 residues), 121.1 bits, see alignment E=4.4e-39 PF01966: HD" amino acids 281 to 401 (121 residues), 61.7 bits, see alignment E=8.3e-21

Best Hits

Swiss-Prot: 54% identical to CGAP3_VIBCH: 3'3'-cGAMP-specific phosphodiesterase 3 (VC_A0931) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 64% identity to mch:Mchl_1412)

Predicted SEED Role

"Response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>ABIE40_RS05520 HD-GYP domain-containing protein (Rhizobium sp. OAE497)
MSGIQIRLAEIIEALSKALDLTEGQPPGHCIRACYIGTHIGRELGLPDGELQDLYYTLLL
KDLGCSSNAARICEIYLADDLAFKRDFKLVDGSLGQVLRFVIGHTGMQAGLAERFRGILN
ILQNGGEIVTDLIQTRCQRGAEIARMMRFSEAVANGILGLDEHWNGGGRPIGLSGTEIPL
FSRIALLSQIADIFQASGGPEASKAEIAKRSGTWFDPDLTAAFARVAARPDFWEILRSEA
LEEVVLSSEPGQQAIMADDDYLDDIAAAFAKVIDAKSPYTSGHSDRVALFTDLIAEEMGI
DAEGRRFLKRAALLHDIGKLGVSNSVLDKPGKLEGEEWEQMKRHSEFSELILSRIHAFSE
AAVIGGAHHERLDGKGYPRGLTAEAIPMEVRIVSTADVFDALTADRPYRAAMPIAKALAI
LWEGAGQSHDPVCITALERALDRTAIEKKAAA