Protein Info for ABIE40_RS05020 in Rhizobium sp. OAE497

Annotation: monovalent cation/H(+) antiporter subunit G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03334: PhaG_MnhG_YufB
  • amino acids 13 to 92 (80 residues), 91.8 bits, E=1.3e-30
• TIGR01300: monovalent cation/proton antiporter, MnhG/PhaG subunit
  • amino acids 13 to 106 (94 residues), 94.9 bits, E=1.4e-31

Best Hits

Swiss-Prot: 63% identical to Y998_RHIME: UPF0091 protein R00998 (R00998) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05571, multicomponent Na+:H+ antiporter subunit G (inferred from 69% identity to rlt:Rleg2_0880)

Predicted SEED Role

"Na(+) H(+) antiporter subunit G" in subsystem Sodium Hydrogen Antiporter

Protein Sequence (110 amino acids)

>ABIE40_RS05020 monovalent cation/H(+) antiporter subunit G (Rhizobium sp. OAE497)
MMEYAIAILVSLLMLGGAFFALAAAIGVLRLPDLYSRMHAASKAGTVGSGLLLLAAGTYS
GEFAIFARALAGIVFLLLTAPVAAHLLAKAAHATGHKLWDGSVRDEMRKR