Protein Info for ABIE40_RS04960 in Rhizobium sp. OAE497

Annotation: hemolysin III family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details PF03006: HlyIII" amino acids 20 to 208 (189 residues), 93.4 bits, see alignment E=8.4e-31

Best Hits

KEGG orthology group: K11068, hemolysin III (inferred from 86% identity to rlg:Rleg_0995)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>ABIE40_RS04960 hemolysin III family protein (Rhizobium sp. OAE497)
MTEFNGIRWAYDKYELIADGIVHGVGLALALVGATVLIFYATVWSSHGELAAAWVYGIGL
VMTIGISFTYNAWPVSRTKWFLRRLDHSSIFILIAATYTPFLERGSDDPLLFSMLIGIWV
VAIVGILLKCVFPGRYDKLAILLYLAMGWSGVLVAEPVASRIPFASMLLIVIGGVIYSAG
VIFHVWEKLRFQNAIWHGFVVAAAAVHYSAVLTCFSMSAL