Protein Info for ABIE40_RS04530 in Rhizobium sp. OAE497

Annotation: HdeD family acid-resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 155 to 179 (25 residues), see Phobius details PF03729: DUF308" amino acids 22 to 90 (69 residues), 53.8 bits, see alignment E=9.8e-19 amino acids 77 to 145 (69 residues), 38.8 bits, see alignment E=4.5e-14

Best Hits

KEGG orthology group: None (inferred from 80% identity to rlt:Rleg2_0779)

Predicted SEED Role

"FIG00985026: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>ABIE40_RS04530 HdeD family acid-resistance protein (Rhizobium sp. OAE497)
MASVLGMPSSSLHSKWIWFAGLGVLLMICGVIAFANIFVATVASVYYVGMLMLAGGIVYL
AHAFQVRGWDHILFWVLSGLLYVLAGLFAFMNPILASAALTLFLAVALVIAGVFRVWVGR
RMKPAKGWGWIVASGVVTALAGFVIALGWPVNSLWILGLFLAADLLLQGSTMLAFGLALR
RSL