Protein Info for ABIE40_RS04015 in Rhizobium sp. OAE497

Annotation: pyridoxamine 5'-phosphate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00558: pyridoxamine 5'-phosphate oxidase
  • amino acids 15 to 206 (192 residues), 227.2 bits, E=8.9e-72
• PF01243: Putative_PNPOx
  • amino acids 25 to 111 (87 residues), 92.1 bits, E=3e-30
• PF12766: Pyridox_oxase_2
  • amino acids 29 to 107 (79 residues), 40.7 bits, E=4.6e-14
• PF10590: PNP_phzG_C
  • amino acids 164 to 206 (43 residues), 58.1 bits, 9.6e-20

Best Hits

Swiss-Prot: 89% identical to PDXH_RHIL3: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 90% identity to rlg:Rleg_0634)

MetaCyc: 40% identical to pyridoxine phosphate oxidase (Saccharomyces cerevisiae)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

• pyridoxal 5'-phosphate salvage II (plants) (9/9 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate salvage I (6/6 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.5

Use Curated BLAST to search for 1.4.3.5

Protein Sequence (206 amino acids)

>ABIE40_RS04015 pyridoxamine 5'-phosphate oxidase (Rhizobium sp. OAE497)
MSANELTSGDFTQRGEPFKLFAEWLKEAEASEVNDPNAVALATVDEAGLPNVRMVLLKGF
DTAGFVFYTNFESQKGREILGQKKAAMCFHWKTLRRQVRLRGPVEVVTDEEADVYFQSRA
RGSRIGAWASKQSRPLESRFALEKSVAEYTARYAIGEIPRPAYWSGFRIKPVSIEFWKDQ
NFRLHDRVEFRRETPEADWDKVRMYP