Protein Info for ABIE40_RS03955 in Rhizobium sp. OAE497

Annotation: energy-coupling factor transporter transmembrane protein EcfT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 39 to 56 (18 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 91 to 115 (25 residues), see Phobius details PF02361: CbiQ" amino acids 9 to 196 (188 residues), 45.6 bits, see alignment E=3.4e-16

Best Hits

Swiss-Prot: 67% identical to BION_RHIEC: Energy-coupling factor transporter transmembrane protein BioN (bioN) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K02008, cobalt/nickel transport system permease protein (inferred from 71% identity to rlg:Rleg_0623)

Predicted SEED Role

"Transmembrane component BioN of energizing module of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>ABIE40_RS03955 energy-coupling factor transporter transmembrane protein EcfT (Rhizobium sp. OAE497)
MQSLYVEGESFMHRLPARAKLAVLAILGVILFTTRDIPLLSLAVLATAAIYFRLGIPLAQ
ALDRLKPVLLTIAIVALFSLAFNPWHGAVVALLRLTSLMFFAAAVTATTTIAEFIDEITL
LARPLERIGLVQANDVGLAVGLVVRFVPEILGRYQAIKEAHAARGIKVRPVTLLAPLIIL
TLRDADNIAAAIDARGIRRHVS