Protein Info for ABIE40_RS03800 in Rhizobium sp. OAE497

Annotation: HAD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF00702: Hydrolase" amino acids 6 to 198 (193 residues), 76.4 bits, see alignment E=9.8e-25 PF12710: HAD" amino acids 9 to 193 (185 residues), 31.5 bits, see alignment E=5.9e-11 PF13419: HAD_2" amino acids 105 to 199 (95 residues), 63.7 bits, see alignment E=6.1e-21 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 119 to 197 (79 residues), 39.5 bits, see alignment E=3.8e-14 PF13242: Hydrolase_like" amino acids 160 to 229 (70 residues), 39.7 bits, see alignment E=9.5e-14

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 84% identity to ara:Arad_1091)

Predicted SEED Role

"Hydrolase, haloacid dehalogenase-like family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>ABIE40_RS03800 HAD family hydrolase (Rhizobium sp. OAE497)
MALDGIRGILFDKDGTLLDYDESWLPVNRELARIASQDDAALADHLLRETGMDPVSGHIV
PDSLLAAGNTRQIAEGLVAAGSRVEVTELTIKLDTLFSNAAEFSVPVTDLAGFFARLHAR
GFKLGIASSDNERSIRQTAQRFGFAQYVDYIAGYDSGFGSKPEAGMVLGFCKATGLAPSE
IAVVGDNNHDLHMGHNANAGLKVAVLTGTGSRESLSAASDYCLNDITELETLLPGLQPA