Protein Info for ABIE40_RS03255 in Rhizobium sp. OAE497

Annotation: isocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 TIGR01346: isocitrate lyase" amino acids 14 to 243 (230 residues), 309.6 bits, see alignment E=1.7e-96 PF00463: ICL" amino acids 15 to 243 (229 residues), 176.1 bits, see alignment E=1.1e-55 amino acids 242 to 424 (183 residues), 170.1 bits, see alignment E=7.3e-54 PF13714: PEP_mutase" amino acids 70 to 227 (158 residues), 53.2 bits, see alignment E=3.2e-18

Best Hits

Swiss-Prot: 70% identical to ACEA_BACHD: Isocitrate lyase (aceA) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 92% identity to rlt:Rleg2_0373)

MetaCyc: 67% identical to isocitrate lyase subunit (Mycobacterium tuberculosis H37Rv)
Isocitrate lyase. [EC: 4.1.3.1]

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>ABIE40_RS03255 isocitrate lyase (Rhizobium sp. OAE497)
MTEFDKLIRNAPAGRFDGIERPYSAEDVRRLRGSVEISHSLAEMGAARLWELLRRDDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELAKRINRT
LQRADQIETSEGKGLSVENWFAPIVADAEAGFGGPLNAFEIMKAYIEAGVAGVHFEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGVSTLVIARTDAEAAKLLTSDIDERDQ
PFVDYDAGRTVEGFYQVRNGLEPCIARAVAYAPYCDLIWCETSKPDLDQARRFAEGVHKV
HPGKLLAYNCSPSFNWRKNLDEATIARFQRELGAMGYKFQFITLAGFHQLNFGMFELARG
YKSRQMAAYSELQQAEFAAEVNGYTATKHQREVGTGYFDAVSLAITGGLSSTTAMRESTE
HAQFKPAAE