Protein Info for ABIE40_RS03205 in Rhizobium sp. OAE497

Annotation: FAD-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 407 to 428 (22 residues), see Phobius details PF01494: FAD_binding_3" amino acids 37 to 68 (32 residues), 25.1 bits, see alignment (E = 3.6e-09) PF01266: DAO" amino acids 38 to 388 (351 residues), 230.9 bits, see alignment E=1.2e-71 PF13450: NAD_binding_8" amino acids 41 to 70 (30 residues), 25.3 bits, see alignment (E = 5.3e-09)

Best Hits

Swiss-Prot: 72% identical to ORDL_RHIME: Probable oxidoreductase OrdL (ordL) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 84% identity to rlg:Rleg_0396)

Predicted SEED Role

"Oxidoreductase"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>ABIE40_RS03205 FAD-binding oxidoreductase (Rhizobium sp. OAE497)
MALKQDWQSPIAPGVSWYQATAGERATYPELDGSKTCDVAIVGGGYTGLQAAYNLAKAGV
SVVLIDANRFGDGASGRNGGQLGTGQRWWPEELEEKIGYERSRALFDLAEGAKKHLLDFA
SEHQIDIEFMPGQINVAHKESYKRSYIENAEIAATRYDYPHVQFMDRQETQERLGSKRYH
CGVRDTGTGHIHPLKLLIGLARVAANAGAQIYEMTPATAVRNDGGKVRIDTPKGTITADK
ALIACNGYIGNLEPVTASHVMPIRSFIGATAPLDSFPSVIPGGEAVADSRFVVRYFRKSR
DGRLLFGGREAYTADNPRDISDHIRRQITEIYPALKDVEITHAWGGSVGITMPRQPFVRE
VMPNVTSIGGYSGHGVMLSNYCGKLYAETVLGKSADLDLFKGLDIPAFPGGAAMRAPLLF
LALSWFALRDKF