Protein Info for ABIE40_RS03055 in Rhizobium sp. OAE497

Annotation: chemotaxis protein MotC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details

Best Hits

Swiss-Prot: 51% identical to MOTC_RHIME: Chemotaxis protein MotC (motC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10564, chemotaxis protein MotC (inferred from 68% identity to rlt:Rleg2_0334)

Predicted SEED Role

"Chemotaxis protein motC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>ABIE40_RS03055 chemotaxis protein MotC (Rhizobium sp. OAE497)
MARRKHHRLLSIALGLALAAPAAARADEQEDLAPYKMLRSLQFVQDSVVSGDHSAAEMQR
FMLGTIDQRLRTVDPAVFDDDRNVDAALVYAMSGGNPATLEYLVSRDVNGYFDNRVTDVL
RKYLSGKGLLVAKTLVETANEYRDKKIGPYLSLVGGNVMVARSPLEALKLYDQARLSAPG
TIVEEAALRRSVAISVEAGLVDKGMAYSQRYVRRFLHSPYASQFADLFVKLIVDHEHDVK
TEDVVSILSFMDDARQREVYLRIARAAGIAGKVELSKTAAEHAQALSGGETDPLGALASF
YGNMASVSTPDVDSAAQHIGKVADGDLSDRDKALRAAARSVAEQVLKAPDPASLTQASDS
TSSNEENTSEQAAVTTDAESQSPTAPPSEPVDDGAAPALPADSSQDQQNADPAYKSFMAA
NRSKLDDIDKLLGEEGN