Protein Info for ABIE40_RS02945 in Rhizobium sp. OAE497

Annotation: FliM/FliN family flagellar motor switch protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF01052: FliMN_C" amino acids 230 to 300 (71 residues), 52.4 bits, see alignment E=2e-18

Best Hits

Swiss-Prot: 52% identical to FLIM_RHIME: Flagellar motor switch protein FliM (fliM) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02416, flagellar motor switch protein FliM (inferred from 76% identity to rlg:Rleg_0344)

Predicted SEED Role

"Flagellar motor switch protein FliM" in subsystem Bacterial Chemotaxis or Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>ABIE40_RS02945 FliM/FliN family flagellar motor switch protein (Rhizobium sp. OAE497)
MNNVALENPAMNAALLAKLTGRLGDKATIEKLCAAFADVYIEFMPDMFKSETGLDVTIAY
LGCDSGYKNDLIADLGANSTLVDATLRNWSQDITLACGNGFVITLMESLLGAAPETIEPP
ADRLLSAIELELAVMVFDKIAGVLRSAVNAPGGFEPALELPHALENRPKPADDKADEFGA
AINMSITLAGITSEFSLIVLQQALLKTQISAPKAKSQASKSAAWTEQISEQVRRSQVTLE
AKIRLQDLTLRTISKLAAGDVIPFRDSGDVRVEVSANSKELYVCEFGRSGENYTVRVKDT
MSSDDELIRHLMN