Protein Info for ABIE40_RS02380 in Rhizobium sp. OAE497

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 transmembrane" amino acids 195 to 217 (23 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 513 to 538 (26 residues), see Phobius details amino acids 558 to 578 (21 residues), see Phobius details amino acids 590 to 612 (23 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 264 to 489 (226 residues), 72.1 bits, see alignment E=1.4e-23 PF00535: Glycos_transf_2" amino acids 294 to 395 (102 residues), 28.1 bits, see alignment E=3.7e-10 PF13506: Glyco_transf_21" amino acids 327 to 487 (161 residues), 24 bits, see alignment E=4.7e-09 PF13632: Glyco_trans_2_3" amino acids 351 to 536 (186 residues), 78.9 bits, see alignment E=9.2e-26

Best Hits

Predicted SEED Role

"Glycosyl transferase, group 2 family protein, a member of the cellulose synthase superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (634 amino acids)

>ABIE40_RS02380 glycosyltransferase family 2 protein (Rhizobium sp. OAE497)
MRIGEYAPGGAINGARENHGSNTQTISAAAEDDDLFRTEARVLLELGIGKPMIAEAVALA
RANGTSIEEQLLASGWLLPENYYAGLARMLRLDFAETLDPDLIYDIDNLDSQLLDPKMLK
LHHMPQSMNVIVPQARQIPALQARLAARPDLRPHMQVTTPSEMRRAVWERGAQRRVRQSV
NTLFDREPDMSARIVLLGKQGFVAGVAVTALAAGILASADVLLLLHLFVSLFYLAAMAIR
FLALAKPAPRFNLRAEENGPLPIYTVMVGLYREAAVAEQLAACLKRLNWPVSKLDIKLVC
EADDRETIAALKAQDLGPHFEIVEVPAARPRTKPKALNYALTSARGKYLAVYDAEDRPHP
DQLREAHATFLRSPDDIVCLQAPLVIANARDSWISAAFALEYSALFRMLLPVLAMLRLPM
PLGGTSNHFKTKILKDAGGWDPHNVTEDADLGMRLYRRGYRCGVLSSHTLEDAPSTAKTW
LHQRTRWFKGWLQTWLVLMRDPAQLLREMGISGFVVFQLLIAGMLLSALAHPWMLFFIGS
SIIDLFQQDAVMDPAHRVLLVMDSCNVIASYILFILLGRKRMTPWERRALRLRWLALPLY
WMMLSMAAWRAVWQLRSNPFFWEKTPHAPSRKTA