Protein Info for ABIE40_RS02280 in Rhizobium sp. OAE497

Annotation: phosphate regulon sensor histidine kinase PhoR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 72 to 406 (335 residues), 360.4 bits, see alignment E=4.2e-112 PF00512: HisKA" amino acids 184 to 249 (66 residues), 66.6 bits, see alignment E=2.5e-22 PF02518: HATPase_c" amino acids 297 to 406 (110 residues), 94.3 bits, see alignment E=9.7e-31 PF13581: HATPase_c_2" amino acids 300 to 387 (88 residues), 28.5 bits, see alignment E=2e-10

Best Hits

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 82% identity to rlt:Rleg2_0167)

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>ABIE40_RS02280 phosphate regulon sensor histidine kinase PhoR (Rhizobium sp. OAE497)
MARIRQERPVLLAALVIGLVALVSGMNKWGVLALVVLMLLVVVMNAEPAVQAKLAEIPEP
EPEAPKSRLPEVAATLAGLDIPVMVLSGDASVLFQNRAAEKAFGEMIIGAHLSARLRSPG
ILDMVRETIATNAPNQIEHSERLPSERVYIVRSAPIDLGEGEGGERFFMLSFRDISEVRR
IDRMRSDFVANASHELRTPLASLRGFIETIQGPAKNDAKAQERFLGIMFDQTTRMSRLVD
DLLSLSRLELKSHIAPDEKVDLVPLLGHVRDSLQPLAKDVGVEINLNLPEGRAEVLGDRD
ELVQVFENLIENACKYGQEGKTVDVSIKNGQGQPVEVTVADRGPGIPAEHVPRLTERFYR
VNIEDSRSKKGTGLGLAIVKHILTRHRARLIVKSEVGKGTAFTVRF