Protein Info for ABIE40_RS02205 in Rhizobium sp. OAE497

Annotation: zinc-binding alcohol dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 165 to 178 (14 residues), see Phobius details PF08240: ADH_N" amino acids 25 to 129 (105 residues), 103.3 bits, see alignment E=1.4e-33 PF16912: Glu_dehyd_C" amino acids 149 to 335 (187 residues), 46.2 bits, see alignment E=7.8e-16 PF00107: ADH_zinc_N" amino acids 170 to 297 (128 residues), 72.9 bits, see alignment E=5e-24 PF13602: ADH_zinc_N_2" amino acids 212 to 316 (105 residues), 29.5 bits, see alignment E=2.8e-10

Best Hits

KEGG orthology group: None (inferred from 89% identity to rec:RHECIAT_CH0000560)

Predicted SEED Role

"Sorbitol dehydrogenase (EC 1.1.1.14)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>ABIE40_RS02205 zinc-binding alcohol dehydrogenase family protein (Rhizobium sp. OAE497)
MKAVLCQKPGVLETVERPSPGTPAPGSVRLAVSHVGICGTDYHIFEGKHPFLEYPRVMGH
EISATVLEAGDGVAMAVGTPVIVNPYLSCGSCVACRKDKPNCCTNIKVLGVHTDGAFCEE
ITVPAGNLYAAKGLSLEAAATVEFLAIGAHAVRRSMAPAGSRSLVIGAGPIGLGAAIFSR
IAGHEVTLLDTSAERLQMAAERFGFQSGVVANEAVADAVKAATDGDGFDVVFDATGYGPS
MEKAFGFVAHGGALVLVSVVKDDIRFSDPEFHKREMMVIGSRNATRVDFEHVADSIAKGL
VPVEKLITHRTTLADAPRDLARWAHEKSGLIKAVIKVAG