Protein Info for ABIE40_RS02175 in Rhizobium sp. OAE497

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 54 to 78 (25 residues), see Phobius details amino acids 99 to 127 (29 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 70 to 233 (164 residues), 73.6 bits, see alignment E=9e-25

Best Hits

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 89% identity to ret:RHE_CH00482)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>ABIE40_RS02175 ABC transporter permease (Rhizobium sp. OAE497)
MKFVVANIFRVAAFVLLLILLFRTEWLSFMLVPLTSNNAPPVYTQNSLPSLALAHLELVI
GSIICTAILAILAGVFVTRKSGADFLPLSRAIANAGQTFPPVAVLALAVPATGFGAGPTL
IALFLYSLLPIFENTVSGIRQVNPAVLDAADGMGMNPTQRLFKVELPLALPLILEGLKVA
TVINIGTATIGSTVAAKGLGEVIIAGLISDNTAFILQGGLIVGLMAVLIYDAMGVVESAI
TRRIGLRPA