Protein Info for ABIE40_RS01720 in Rhizobium sp. OAE497

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF00583: Acetyltransf_1" amino acids 31 to 138 (108 residues), 53.4 bits, see alignment E=6.3e-18 PF13673: Acetyltransf_10" amino acids 49 to 144 (96 residues), 35.9 bits, see alignment E=1.4e-12 PF13508: Acetyltransf_7" amino acids 56 to 140 (85 residues), 36.9 bits, see alignment E=8e-13 PF08445: FR47" amino acids 82 to 142 (61 residues), 36.2 bits, see alignment E=9.6e-13

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 86% identity to rec:RHECIAT_CH0000419)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.128

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>ABIE40_RS01720 N-acetyltransferase (Rhizobium sp. OAE497)
MTMLEAYLTLKPEFEIVPMDGDDCHAVAVLHGERFARPWGDGEFHSLLSQDNVFGFVARQ
TNAFLKKPLPGFVLARQVAGEAEILTVAVQAKAARSGLGWRLMQAAMREAHARGGESLFL
EVDAGNAPALGLYRKLGFEKVGERRGYYKDDKGAVSTALVMKRVLR