Protein Info for ABIE40_RS01585 in Rhizobium sp. OAE497

Annotation: bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 26 to 257 (232 residues), 285.5 bits, E=8.3e-89
• TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase
  • amino acids 30 to 257 (228 residues), 270.2 bits, E=5.7e-85
• PF13489: Methyltransf_23
  • amino acids 61 to 240 (180 residues), 28.1 bits, E=4.5e-10
• PF13847: Methyltransf_31
  • amino acids 69 to 195 (127 residues), 65.1 bits, E=1.9e-21
• PF13649: Methyltransf_25
  • amino acids 74 to 171 (98 residues), 67 bits, E=6.1e-22
• PF08242: Methyltransf_12
  • amino acids 75 to 173 (99 residues), 42.8 bits, E=2.2e-14
• PF08241: Methyltransf_11
  • amino acids 75 to 175 (101 residues), 64.9 bits, E=2.6e-21

Best Hits

Swiss-Prot: 92% identical to UBIE_RHIE6: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Rhizobium etli (strain CIAT 652)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 91% identity to ret:RHE_CH00354)

MetaCyc: 58% identical to 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (Cereibacter sphaeroides)
RXN-9235 [EC: 2.1.1.201]

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-) @ 2-heptaprenyl-1,4-naphthoquinone methyltransferase (EC 2.1.1.163)" (EC 2.1.1.-, EC 2.1.1.163)

MetaCyc Pathways

• menaquinol-4 biosynthesis I (1/1 steps found)
• menaquinol-6 biosynthesis (1/1 steps found)
• menaquinol-8 biosynthesis (1/1 steps found)
• menaquinol-9 biosynthesis (1/1 steps found)
• menaquinol-10 biosynthesis (1/2 steps found)
• menaquinol-11 biosynthesis (1/2 steps found)
• menaquinol-12 biosynthesis (1/2 steps found)
• menaquinol-13 biosynthesis (1/2 steps found)
• menaquinol-7 biosynthesis (1/2 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (4/8 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (6/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (3/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (3/9 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)
• superpathway of menaquinol-8 biosynthesis I (2/10 steps found)
• superpathway of menaquinol-8 biosynthesis II (2/10 steps found)
• superpathway of chorismate metabolism (37/59 steps found)
• superpathway of menaquinol-10 biosynthesis (1/10 steps found)
• superpathway of menaquinol-11 biosynthesis (1/10 steps found)
• superpathway of menaquinol-12 biosynthesis (1/10 steps found)
• superpathway of menaquinol-13 biosynthesis (1/10 steps found)
• superpathway of menaquinol-6 biosynthesis (1/10 steps found)
• superpathway of menaquinol-7 biosynthesis (1/10 steps found)
• superpathway of menaquinol-9 biosynthesis (1/10 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Protein Sequence (258 amino acids)

>ABIE40_RS01585 bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE (Rhizobium sp. OAE497)
MSDSRTSADGGMETSYGFREVQNGEKQGLVNEVFHKVAKRYDIMNDVMSAGMHRVWKDAM
IASLNPRKEAGYKVLDVAGGTGDIAFRIVEASNRLAHATVLDINGSMLGVGAERAAKKKL
SDNLTFVEANAEDLPFEANSFDAYTIAFGIRNVPRIDVALSEAYRVLKRGGRLLVLEFSE
VELPVLDNVYDAWSFNAIPKFGKAITGDAEPYQYLVESIRKFPNQENFAAMIREAGFSRV
SYTNYTGGIAALHSGWKL