Protein Info for ABIE40_RS01545 in Rhizobium sp. OAE497

Annotation: SRPBCC domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF10604: Polyketide_cyc2
  • amino acids 14 to 123 (110 residues), 31.6 bits, E=1.8e-11
• PF08327: AHSA1
  • amino acids 21 to 152 (132 residues), 108.8 bits, E=2.2e-35

Best Hits

KEGG orthology group: None (inferred from 39% identity to ret:RHE_CH01075)

Predicted SEED Role

"Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)" (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• pentachlorophenol degradation (5/10 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Protein Sequence (160 amino acids)

>ABIE40_RS01545 SRPBCC domain-containing protein (Rhizobium sp. OAE497)
MASDVSPAVRSREIVLVREIDAPRELVFRLWTEPEHLLKWWGPHNCSAPSVSVDLREGGA
WRHCILAPDGKEYWSRGRYIEITPPERLVFTFAWENSAGQPEHEMQAIVELEDKGGRTKL
TFRKHQLPSDTEFKLQSSGWAEALDKVAAYAEEQAGRRAS