Protein Info for ABIE40_RS01535 in Rhizobium sp. OAE497

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details amino acids 321 to 345 (25 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details amino acids 384 to 404 (21 residues), see Phobius details PF07690: MFS_1" amino acids 33 to 253 (221 residues), 97 bits, see alignment E=1.1e-31 amino acids 237 to 403 (167 residues), 46.7 bits, see alignment E=2.2e-16 PF00083: Sugar_tr" amino acids 65 to 210 (146 residues), 32.3 bits, see alignment E=5.5e-12

Best Hits

KEGG orthology group: K08224, MFS transporter, YNFM family, putative membrane transport protein (inferred from 82% identity to rle:RL0362)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>ABIE40_RS01535 MFS transporter (Rhizobium sp. OAE497)
MSDISPIEVTEAPPAKQYLTRGTLPYRRASLALFLSGFSTFSLLYCVQPLLPVFASDYAV
SPAQSSLALSLSTGFLAVAIICAAAVSEGLGRRSLMSISLVGAAVLTIAAAFAPNWHVLL
MLRALLGFVLGGVPAVAMAYLAEEIDPKGLGATMGLYVGGTAFGGMSGRVLTGIFAEYLS
WRPAMALMGVIGLAAAIGFIVLLPASRNFIRRPGFDPRFHLKAWAGHLQNPALPFVFSIA
FLAMGSFVTIYNYAGFRLVASPYELTQTELGLIFTVYMFGIGASSIGGILGDRFGHFAVL
LTGLAVTAAGSALTLSSSLPVIILGIIVLTSGFFMSHSIASGLVGKLAKGTKGHASSLYM
LAYYVGSSVMGSAGGWFFSAEGWSAVVFFTLAMLLCAFACAYGARRLSKAARV