Protein Info for ABIE40_RS00645 in Rhizobium sp. OAE497

Annotation: nicotinate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01514: nicotinate phosphoribosyltransferase
  • amino acids 20 to 421 (402 residues), 304.6 bits, E=5.7e-95
• PF17767: NAPRTase_N
  • amino acids 25 to 149 (125 residues), 85.6 bits, E=3.5e-28
• PF04095: NAPRTase
  • amino acids 190 to 419 (230 residues), 169.5 bits, E=1.1e-53

Best Hits

Swiss-Prot: 95% identical to PNCB_RHIEC: Nicotinate phosphoribosyltransferase (pncB) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 95% identity to rec:RHECIAT_CH0000225)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• NAD salvage (plants) (6/11 steps found)
• superpathway of NAD biosynthesis in eukaryotes (6/14 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.11

Protein Sequence (434 amino acids)

>ABIE40_RS00645 nicotinate phosphoribosyltransferase (Rhizobium sp. OAE497)
MAKTDIARRVYNHAWKLDPIVRSLIDTDFYKLLMLQMIWKLYPDVNATFTLINRTKRVLL
AEEIDEGELREQLDHARTLRLSKKEMIWLAGNSFYGRAQIFEPEFLAWFSHFQLPEYELS
KKDGQYVLDFHGSWKETTMWEIPALAIINELRSRSAMKALGPFTLDVLYARAKARMWTKV
ERLKELPGLRISDFGTRRRHSFLWQRWCVEALKEGIGPAFTGTSNVLLAMDSDLEAVGTN
AHELPMVAAALAQTDDDLAKAPYKVLRDWNRLYGGNLLIVLPDAFGTTAFLRDAPEWVAD
WTGFRPDSAPPVEGGEKIIEWWKKMGRDPRQKLLIFSDGLDVDAIIDTYKHFEGRVRMSF
GWGTNLTNDFAGCAPTEISGLNPISVVCKVSDANGRPAVKLSDNPQKATGEPAEVERYLK
FFGAEDRVDQEVFV