Protein Info for ABIE40_RS00565 in Rhizobium sp. OAE497

Annotation: phosphonate C-P lyase system protein PhnH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF05845: PhnH" amino acids 11 to 197 (187 residues), 221.5 bits, see alignment E=4.1e-70 TIGR03292: phosphonate C-P lyase system protein PhnH" amino acids 11 to 196 (186 residues), 201.9 bits, see alignment E=3.7e-64

Best Hits

Swiss-Prot: 61% identical to PHNH_RHIME: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH (phnH) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06165, PhnH protein (inferred from 75% identity to rle:RL0176)

Predicted SEED Role

"PhnH protein" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>ABIE40_RS00565 phosphonate C-P lyase system protein PhnH (Rhizobium sp. OAE497)
MELRNDTLTGGFAEPVFQAQSVFKAMMDAMARPGSIQTLSPDAAPPAPMGAAAGAIALTL
CDHDTPVWLSPALNKSAVPGWLSFHTGATVTTEKSEARFAFVDSGMALSTFGLFAPGTQE
YPDRSTTVVIEIAALDGGKMLALMGPGIKTVTEIAPVGLPETFIRLWNENRVLFPRGVDI
VLAAGSSFLCLPRTTKITATEM