Protein Info for ABID97_RS29360 in Variovorax sp. OAS795

Annotation: alcohol dehydrogenase catalytic domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08240: ADH_N
  • amino acids 28 to 156 (129 residues), 78.5 bits, E=4.2e-26
• PF00107: ADH_zinc_N
  • amino acids 197 to 327 (131 residues), 45.3 bits, E=8.2e-16

Best Hits

KEGG orthology group: K00001, alcohol dehydrogenase [EC: 1.1.1.1] (inferred from 64% identity to rhi:NGR_c25690)

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (16/19 steps found)
• heterolactic fermentation (15/18 steps found)
• ethanolamine utilization (5/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• ethanol degradation II (3/3 steps found)
• ethanol degradation I (2/2 steps found)
• mixed acid fermentation (12/16 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• acetaldehyde biosynthesis I (1/1 steps found)
• phytol degradation (3/4 steps found)
• L-isoleucine degradation II (2/3 steps found)
• L-leucine degradation III (2/3 steps found)
• L-valine degradation II (2/3 steps found)
• pyruvate fermentation to ethanol I (2/3 steps found)
• pyruvate fermentation to ethanol III (2/3 steps found)
• pyruvate fermentation to ethanol II (1/2 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• L-methionine degradation III (1/3 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
• cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
• salidroside biosynthesis (1/4 steps found)
• serotonin degradation (3/7 steps found)
• phenylethanol biosynthesis (1/5 steps found)
• butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Drug metabolism - cytochrome P450
• Fatty acid metabolism
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Metabolism of xenobiotics by cytochrome P450
• Retinol metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Protein Sequence (369 amino acids)

>ABID97_RS29360 alcohol dehydrogenase catalytic domain-containing protein (Variovorax sp. OAS795)
MTTMKAARLHKVGAPMEVEQLPIPQPAANDVQVRVHACGIVPNLGNILANWTTWFPELPL
PPLPAIFGLDPAGEVTAVGSHVHTWKPGDRVYVNPSLYCGGCRACRNGDLVNCTHYAFSG
YFGFSQDSLKLYKNYPYGGLCEYMIAPQYALVKLPDNVSFNQAARFGYLGTMYSAMRKAR
VGPGRSVLINGISGTLGIGGALFGLAMGATRILGTGRNRELLERVKALAPDRIEVFSNAD
GEAIDTWAKARTDGLGVDTFIDALGPGAPHETFQQGVRALKRGGRAFNIGAIAGMVGMDL
HTMMDEQQSIEGSAWFTAGEGQDMADMAEAGTLDLSVFEHVCYPLDRINEAISGIASRNG
GFSNFVINP