Protein Info for ABID97_RS29290 in Variovorax sp. OAS795

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 9 to 33 (25 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 155 to 179 (25 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 276 (193 residues), 50.3 bits, see alignment E=1.3e-17

Best Hits

Swiss-Prot: 32% identical to Y4OQ_SINFN: Probable ABC transporter permease protein y4oQ (NGR_a02190) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 86% identity to vap:Vapar_3349)

Predicted SEED Role

"sugar ABC transporter, permease protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>ABID97_RS29290 sugar ABC transporter permease (Variovorax sp. OAS795)
MRTSPWVPAFYLGPAVLIMAAACLYPVVSAFQLGFFDWSMGTPWSEARWVGLDSFVSAFS
NPRVWSSLWTTLQFAAVSVTAEMVLGIALALALERPVRGTAFFRTLFILPMMIAPIAVGL
AWRYLFDAQFGLVNAVLALFGIAARGWLADPTLAFAAIVVADIWQWTPFVFIMMVAALAN
VDGAVIEASRIDGAKWWQMTFLVKLPMVMHVIAITLMMRLIDAFRVLEVIYVLTFGGPGD
ATEILALHIYKTAFVGQQLGAAAAISVLLLLVVVALSWGALRLSNPLKNDR