Protein Info for ABID97_RS29260 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 38 to 62 (25 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 128 to 153 (26 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 267 to 284 (18 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 320 to 343 (24 residues), see Phobius details amino acids 346 to 373 (28 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 310 (303 residues), 142 bits, see alignment E=1.2e-45

Best Hits

KEGG orthology group: None (inferred from 83% identity to reh:H16_A1743)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>ABID97_RS29260 MFS transporter (Variovorax sp. OAS795)
MDKRLLVLASGMFAIGTDSFVVAGVLGQVSASLGVSVALAGQMVTLYALSYALLSPVVAA
TAAHWPRKRLLLAGLAVFVVGNVITAVAPSIELVLASRLVAGLGAAMFSPTATAAGASLV
PPEQRGRALAIVIAGLSSATALGAPLGTFIGGWLDWRATMWFVAIVGTIAAAGVAWRLPN
IPNLPAVSLARRLAPLGDARVLLTLLTTWLVYAGLFLVYTYIGSSFDRATGGDARVLAGL
LLLWGVAATVGNLAAGRLTDRFGSRRIINVAIALAALDFALLPWSSASLATAVPALIVWG
VCGWGVLVPQQHRLIGITPAAAPLLLGLNSAALYVGVSVSGLAGGAALALIGSHYLGLAG
AVFIAAALFVAEWAHRRIVRTEREPAAVAAAVSGTAR