Protein Info for ABID97_RS29165 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 287 to 312 (26 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 343 to 366 (24 residues), see Phobius details amino acids 378 to 402 (25 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 336 (310 residues), 135 bits, see alignment E=4.8e-43 amino acids 300 to 437 (138 residues), 36.2 bits, see alignment E=5.1e-13 PF00083: Sugar_tr" amino acids 32 to 224 (193 residues), 97.5 bits, see alignment E=1.3e-31 PF06779: MFS_4" amino acids 43 to 177 (135 residues), 34.1 bits, see alignment E=3e-12

Best Hits

Swiss-Prot: 48% identical to BENK_ACIAD: Benzoate transport protein (benK) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05548, MFS transporter, AAHS family, benzoate transport protein (inferred from 89% identity to vap:Vapar_5312)

Predicted SEED Role

"benzoate MFS transporter BenK" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>ABID97_RS29165 MFS transporter (Variovorax sp. OAS795)
MRQIDLHKLADDARFNRFHGLVLLWCALIIVFDGYDLAVVGIALPSIMKKMGVDATNAGF
MVSSALFGMMFGAIFMGTIADRIGRPRAIAICVALFSVFTAAAGLAETPLAFSAMRFLAG
LGIGGVMPNVVAQMTEYSPKKIRATLVTLMFSGYAVGGIIAAILGKGLIESYGWQSVFFA
AGVPVLLIPFILKSMPESMPFLLAKGRVDELRNIAARLEPGYRPVATDSFVVPAKDRADS
APIKHLFYDGRGFSTVMFWIAFFMCLFMVFALSSWLTKLMAGAGYSLGSALTFVLVLNVG
AMVGAIGGGWLADRFHIKYVLAGMYALAAVSLTLLGYKMPTPALFVLIGLAGASTIGTQI
VANAYAGQFYPMAVRATGLGWALGVGRSGAILAPILIGVLVGMNLPLHQNFIAIAIPAVI
GMVAVLLIQHDRSASASALRAEALAAVDKSIAGVPRMPGA