Protein Info for ABID97_RS28865 in Variovorax sp. OAS795

Annotation: TerC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details TIGR03717: integral membrane protein, YjbE family" amino acids 13 to 185 (173 residues), 234.1 bits, see alignment E=4.5e-74 PF03741: TerC" amino acids 15 to 184 (170 residues), 169.9 bits, see alignment E=2.3e-54

Best Hits

Swiss-Prot: 41% identical to YJBE_BACSU: Uncharacterized membrane protein YjbE (yjbE) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_6290)

Predicted SEED Role

"Membrane protein TerC, possibly involved in tellurium resistance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>ABID97_RS28865 TerC family protein (Variovorax sp. OAS795)
MSFLTSPDFWIALSQIILINIVLSGDNAVVIAMASRSLPPAQQKKAILFGSMGAIVLRVV
LTFFAVYLLTLPYLKLVGAALLFWIGIGLLKGEDGEENLEGHSSLAAAIKTIVVADLVMS
LDNVVGVAAAAKGNVPLLVFGLVISIPLIIFGSTLILKLMDRFPIIITLGAALLGWVAGE
MAMSDPSIAGWAADQHALHKIVPAVCAIAVVVIGKWLTSRRKREPEPEPKPANQSV