Protein Info for ABID97_RS28850 in Variovorax sp. OAS795

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 140 to 152 (13 residues), see Phobius details amino acids 164 to 193 (30 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 233 to 259 (27 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 362 to 390 (29 residues), see Phobius details amino acids 396 to 416 (21 residues), see Phobius details PF00654: Voltage_CLC" amino acids 78 to 410 (333 residues), 262.5 bits, see alignment E=6.5e-82 PF00571: CBS" amino acids 445 to 493 (49 residues), 23.9 bits, see alignment 4.4e-09 amino acids 513 to 563 (51 residues), 22.1 bits, see alignment 1.6e-08

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_6375)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (585 amino acids)

>ABID97_RS28850 chloride channel protein (Variovorax sp. OAS795)
MTPASHPPRGDFALNARMLRIAAMAVVIGAFSTIAARVLLDLIRFFTNLFFFQALSLADR
SPAANTLGAWVIAVPVIGGLIVGLVARYGSDKIRGHGIPEAIEAILFGKSRMSAKVALLK
PLSSGIVIGSGGPFGAEGPIIMTGGAIGSLIAQHFHLTAAERKALLVAGATAGMTAVFGT
PVAAVLLAVELLLFELRPRSLLPVAVACAVAGFIRPLLMDPGPLFPLQTAVPGPLAMLSC
LAAGLACGVLSACLSLSLYKVEDLFGKLPLHWMWWPAIGGLAVGIGGYFEPRALGVGYDV
IGDLLNNHLALGVVAALLAVKAVIWVVSLGSGTSGGVLAPLMMMGAGLGAVLSHVLPGND
PLLWPLVCMAATLGGVMRAPLTATIFAFGLTHDSNALLPLLATSAVAYGFTVLTMRRSIL
TEKIARRGYHIYREYGVDPLERHAVEEVMTREVRSIDAGLPVAQALFEYFGDRQVHRAFP
VVRNGAVIGVADRAALAARGTWDPIATVGDACADTPLFFALPGENCRAVATRLARHRLER
LPVVKDAQSLALVGIVARSDLIEPSLAHFDEEEKRERMRGMPWQA