Protein Info for ABID97_RS28765 in Variovorax sp. OAS795

Annotation: SDR family NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00106: adh_short" amino acids 12 to 207 (196 residues), 189 bits, see alignment E=1e-59 PF08659: KR" amino acids 14 to 180 (167 residues), 45.9 bits, see alignment E=9.6e-16 PF13561: adh_short_C2" amino acids 18 to 256 (239 residues), 212.2 bits, see alignment E=1.3e-66

Best Hits

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 78% identity to ctt:CtCNB1_1924)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>ABID97_RS28765 SDR family NAD(P)-dependent oxidoreductase (Variovorax sp. OAS795)
MDALQHLEHRGRVVLVTGAAGGIGTAIAERYAADGAAVGLVDFDAASGQALAARLASAGH
RVHFAQADVASFDACDAACGAIEAALGPIDTLVNNAGISPKHAGRPAPIWQMDPAEWHRV
VDVNLHSVFNFARRLTPGMVDRKFGRIVSMSSVAGKAYLDIVAAHYGTTKAALIGMTRHL
AGELGPHGITVNALAPGRIDTPMVAGAPREANDAVIRVTPLRRLGKPVEVADACLFLSSP
RSGFITGQVIDVAGGWLMT