Protein Info for ABID97_RS28715 in Variovorax sp. OAS795

Annotation: aldehyde dehydrogenase iron-sulfur subunit PaoA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 53 to 100 (48 residues), 38.2 bits, 1.1e-13
• PF01799: Fer2_2
  • amino acids 120 to 207 (88 residues), 99.5 bits, E=9.3e-33

Best Hits

Swiss-Prot: 64% identical to PAOA_ECO57: Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA (paoA) from Escherichia coli O157:H7

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 87% identity to vap:Vapar_5490)

MetaCyc: 63% identical to aldehyde dehydrogenase, Fe-S subunit (Escherichia coli K-12 substr. MG1655)
Carboxylate reductase. [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT"

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.99.6

Protein Sequence (215 amino acids)

>ABID97_RS28715 aldehyde dehydrogenase iron-sulfur subunit PaoA (Variovorax sp. OAS795)
MDSPTNPLISRRGALIVGAATAAAVSSSAPAAAAQAAPAASASAIPRARLSLNVNGQTHA
LELDTRTTLLDALREHLHLTGTKKGCDHGQCGACTVIADGRRINACLSLAVMHDGGQVTT
IEGLGTPQNMHPLQAAFVKHDGYQCGYCTPGQICSAVAVLDEIKRGVPSHASADLTARPL
LSADELRERMSGNICRCGAYSNIVDAITEVAGSRT