Protein Info for ABID97_RS28490 in Variovorax sp. OAS795

Annotation: (2Fe-2S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF00111: Fer2" amino acids 17 to 68 (52 residues), 26 bits, see alignment E=1.1e-09 PF13085: Fer2_3" amino acids 46 to 89 (44 residues), 30.9 bits, see alignment E=3.6e-11 PF01799: Fer2_2" amino acids 83 to 156 (74 residues), 107.5 bits, see alignment E=4.3e-35

Best Hits

Swiss-Prot: 41% identical to NDSFS_EUBBA: Nicotinate dehydrogenase small FeS subunit (ndhS) from Eubacterium barkeri

KEGG orthology group: None (inferred from 63% identity to rpb:RPB_4413)

MetaCyc: 51% identical to 4-hydroxybenzoyl-CoA reductase, gamma subunit (Aromatoleum aromaticum EbN1)
OHBENZCOARED-RXN [EC: 1.1.7.1]

Predicted SEED Role

"Xanthine dehydrogenase iron-sulfur subunit (EC 1.17.1.4)" in subsystem Purine Utilization (EC 1.17.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.1.7.1 or 1.17.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>ABID97_RS28490 (2Fe-2S)-binding protein (Variovorax sp. OAS795)
MNQSTGTFPLVRVDMSLNDTERSVEIEPRELLIDVLRERFRMTGTKRSCDVQVCGACTVL
VDGMPTSSCTTLCADVHNRHVTTIEGLAHEGRLDPVQRAFIAHGALQCGFCTPGMILAVK
SMLSLHDNPSEETIRHFLRGNICRCTGYVKILEAIKDLVQNPLSFEPETK