Protein Info for ABID97_RS28490 in Variovorax sp. OAS795
Annotation: (2Fe-2S)-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 41% identical to NDSFS_EUBBA: Nicotinate dehydrogenase small FeS subunit (ndhS) from Eubacterium barkeri
KEGG orthology group: None (inferred from 63% identity to rpb:RPB_4413)MetaCyc: 51% identical to 4-hydroxybenzoyl-CoA reductase, gamma subunit (Aromatoleum aromaticum EbN1)
OHBENZCOARED-RXN [EC: 1.1.7.1]
Predicted SEED Role
"Xanthine dehydrogenase iron-sulfur subunit (EC 1.17.1.4)" in subsystem Purine Utilization (EC 1.17.1.4)
MetaCyc Pathways
- purine nucleotides degradation I (plants) (10/12 steps found)
- adenosine nucleotides degradation I (7/8 steps found)
- guanosine nucleotides degradation II (4/4 steps found)
- 4-coumarate degradation (anaerobic) (5/6 steps found)
- superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
- adenosine nucleotides degradation II (4/5 steps found)
- guanosine nucleotides degradation I (3/4 steps found)
- guanosine nucleotides degradation III (3/4 steps found)
- inosine 5'-phosphate degradation (3/4 steps found)
- purine nucleotides degradation II (aerobic) (8/11 steps found)
- ureide biosynthesis (5/7 steps found)
- superpathway of purines degradation in plants (12/18 steps found)
- phenol degradation II (anaerobic) (1/4 steps found)
- purine nucleobases degradation II (anaerobic) (15/24 steps found)
- 4-ethylphenol degradation (anaerobic) (2/6 steps found)
- caffeine degradation III (bacteria, via demethylation) (2/7 steps found)
- caffeine degradation IV (bacteria, via demethylation and oxidation) (2/10 steps found)
- theophylline degradation (1/9 steps found)
- anaerobic aromatic compound degradation (Thauera aromatica) (7/27 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.17.1.4
Use Curated BLAST to search for 1.1.7.1 or 1.17.1.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (170 amino acids)
>ABID97_RS28490 (2Fe-2S)-binding protein (Variovorax sp. OAS795) MNQSTGTFPLVRVDMSLNDTERSVEIEPRELLIDVLRERFRMTGTKRSCDVQVCGACTVL VDGMPTSSCTTLCADVHNRHVTTIEGLAHEGRLDPVQRAFIAHGALQCGFCTPGMILAVK SMLSLHDNPSEETIRHFLRGNICRCTGYVKILEAIKDLVQNPLSFEPETK