Protein Info for ABID97_RS28455 in Variovorax sp. OAS795

Annotation: FUSC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 52 (17 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details amino acids 391 to 408 (18 residues), see Phobius details amino acids 418 to 437 (20 residues), see Phobius details amino acids 443 to 461 (19 residues), see Phobius details amino acids 468 to 486 (19 residues), see Phobius details amino acids 495 to 518 (24 residues), see Phobius details PF04632: FUSC" amino acids 12 to 668 (657 residues), 561.7 bits, see alignment E=4.2e-172 PF06081: ArAE_1" amino acids 16 to 122 (107 residues), 29.2 bits, see alignment E=1.4e-10 PF13515: FUSC_2" amino acids 24 to 155 (132 residues), 54.7 bits, see alignment E=1.7e-18

Best Hits

KEGG orthology group: None (inferred from 90% identity to vap:Vapar_4316)

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (672 amino acids)

>ABID97_RS28455 FUSC family protein (Variovorax sp. OAS795)
MIALPRFSRQELLFSLKSFVAAMLALYLASRFGLPRPFWAMMTAYIVAHPLASHVRSKAL
YRLLGTLLGCAASVVLVPSLSGSPELLSLAVALWVGLCLYASLLDRSARSYVFMLAGYSA
ALIGFPLVEAPAAMFDTAVARVTEIGLGILCASLVHSIALPAGLGPSLLGVMDRALGDAR
EWLTDLLCETPTGARDARTAADRQRLALDITQLRLLSTHVPFDTDLRWTGGAIGALQDRV
AALTPVLSAVEDCLQALCTATGGVPDDIGSTFAQQSRWLAPGATNARLDEARAAFRAIAD
GPAASPWIRALRIDLATRLEDLVAHWDTCTTLRNDIDAGVAGNRGPLRRTAALDRRVLHL
DRGLALRSAITAVLGTCLSCALWIATGWPSGSAMPMGTAVFCSFFATMDDPVPAMHKFIT
ALSWSLPVSAFYVLGVMPLAHDFGMLVLCIAPVFLVVGCYMARPASSLSALGMFFGVAGT
LALQDTATADWVSFISSNLALFVGAVIAARVTALMRSVGRDWTAKRIRRSTWHDLADLAA
HPQDASARDAFGSRMLDRIAQLAPRVAPDGPEEVQIAAHRALRELRMGADIAALQRHRGR
LPAEPVNQLFRELALIFRAQGAGAPPRHASLLPHIDRLLLDALMAGTKRPAVAALVGLRR
NLFPTAPAALQP