Protein Info for ABID97_RS28445 in Variovorax sp. OAS795

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 13 to 206 (194 residues), 156.7 bits, E=7.8e-50
• PF08659: KR
  • amino acids 13 to 131 (119 residues), 27 bits, E=5.9e-10
• PF13561: adh_short_C2
  • amino acids 21 to 253 (233 residues), 170.2 bits, E=8.7e-54

Best Hits

Swiss-Prot: 46% identical to RHLG_PSEAE: Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase (rhlG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 96% identity to vap:Vapar_4312)

MetaCyc: 46% identical to NADPH-dependent beta-ketoacyl reductase subunit (Pseudomonas aeruginosa)
3-oxoacyl-[acyl-carrier-protein] reductase. [EC: 1.1.1.100]

Predicted SEED Role

"2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.125)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (31/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (31/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (31/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• 2-deoxy-D-glucose 6-phosphate degradation (2/4 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (26/205 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100, 1.1.1.125

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.125

Protein Sequence (259 amino acids)

>ABID97_RS28445 SDR family oxidoreductase (Variovorax sp. OAS795)
MTTHNLFSLRGRTALVTGGSRGIGRMIAEGFLAQGARVYISARKAAACDLAASELSKNGH
CVSLPYDVSTVAGCQALAAAYAHHETTLDILVNNAGAAWGEDFDAFPESGWDKVVDLNMK
TPFFLTKALSEPLRAAAQERVGKIINIASTDGIALNPQENYSYVASKAGLIHLTRRMALR
LAQDNIAVSAIAPGAFPSEMNRNARDRGEELSEHIPAKRIGTSDDIAGAAIFLASRAGDY
VMGATLVVDGGVTHARAYR