Protein Info for ABID97_RS28345 in Variovorax sp. OAS795

Annotation: nuclear transport factor 2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 31% identical to ANDAD_BURCE: Anthranilate 1,2-dioxygenase small subunit (andAd) from Burkholderia cepacia

KEGG orthology group: K05709, small terminal subunit of phenylpropionate dioxygenase [EC: 1.14.12.19] (inferred from 91% identity to vap:Vapar_4291)

MetaCyc: 54% identical to 6-hydroxypicolinate 3-monooxygenase subunit 4 (Alcaligenes faecalis)
1.14.13.-

Predicted SEED Role

"Ortho-halobenzoate 1,2-dioxygenase beta-ISP protein OhbA" in subsystem Benzoate degradation

MetaCyc Pathways

picolinate degradation (6/7 steps found)
3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (5/8 steps found)
3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation to 2-hydroxypentadienoate (2/5 steps found)
cinnamate and 3-hydroxycinnamate degradation to 2-hydroxypentadienoate (2/5 steps found)

KEGG Metabolic Maps

Phenylalanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.19

Use Curated BLAST to search for 1.14.12.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>ABID97_RS28345 nuclear transport factor 2 family protein (Variovorax sp. OAS795)
MKERLAYAKASISPRRAAELRAEIESFHVEYCAALDANEVERWPDFFSEEATYRVTSRQN
ALLNMPVGLIYCEGLNMIIDRALAVAHSQMFAPRHMLHVLGIARVLQETGDAISSQTPFI
LLQTLVEGPSTVHLAGVYHDRFVREGDRLLLASREVVHDTEILDTALAYPV