Protein Info for ABID97_RS28330 in Variovorax sp. OAS795

Annotation: non-heme iron oxygenase ferredoxin subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF00355: Rieske" amino acids 2 to 88 (87 residues), 74.8 bits, see alignment E=4.3e-25 PF13806: Rieske_2" amino acids 3 to 99 (97 residues), 53.5 bits, see alignment E=2.1e-18

Best Hits

Swiss-Prot: 46% identical to NDOA_PSEAI: Naphthalene 1,2-dioxygenase system, ferredoxin component (ndoA) from Pseudomonas aeruginosa

KEGG orthology group: K05710, ferredoxin subunit of phenylpropionate dioxygenase (inferred from 97% identity to vap:Vapar_4288)

MetaCyc: 53% identical to 6-hydroxypicolinate 3-monooxygenase subunit 1 (Alcaligenes faecalis)
1.14.13.-

Predicted SEED Role

"Ferredoxin subunits of nitrite reductase and ring-hydroxylating dioxygenases"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>ABID97_RS28330 non-heme iron oxygenase ferredoxin subunit (Variovorax sp. OAS795)
MDWIKVASAQELSNDEAKTVDVAGHGVALYRIDDEFFATDSLCTHATALLSEGYVEDGCV
ECPLHQGRFDIRTGKAMCAPVTVDLRTYAVKREGDHIYVLSPAGK