Protein Info for ABID97_RS28300 in Variovorax sp. OAS795

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 PF12418: AcylCoA_DH_N" amino acids 2 to 32 (31 residues), 37.2 bits, see alignment (E = 7.1e-13) PF02771: Acyl-CoA_dh_N" amino acids 36 to 156 (121 residues), 36.5 bits, see alignment E=1.7e-12 PF02770: Acyl-CoA_dh_M" amino acids 161 to 268 (108 residues), 44 bits, see alignment E=6.3e-15 PF00441: Acyl-CoA_dh_1" amino acids 283 to 449 (167 residues), 89.9 bits, see alignment E=5.6e-29 PF08028: Acyl-CoA_dh_2" amino acids 300 to 441 (142 residues), 24.8 bits, see alignment E=6.7e-09 PF12806: Acyl-CoA_dh_C" amino acids 467 to 592 (126 residues), 100.7 bits, see alignment E=2e-32

Best Hits

Swiss-Prot: 57% identical to DMDC_RUEPO: 3-methylmercaptopropionyl-CoA dehydrogenase (dmdC) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 94% identity to vap:Vapar_4282)

MetaCyc: 57% identical to 3-(methylsulfanyl)propanoyl-CoA dehydrogenase monomer (Ruegeria pomeroyi DSS-3)
RXN-12572 [EC: 1.3.99.41]

Predicted SEED Role

"3-methylmercaptopropionyl-CoA dehydrogenase (DmdC)"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.99.- or 1.3.99.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (596 amino acids)

>ABID97_RS28300 acyl-CoA dehydrogenase (Variovorax sp. OAS795)
MSYTAPLKDMLFDIEHLANIGEIAKLPGFEDAGLETAQAVLEECARFNQDVVAPLNVAGD
RNPSSFKDGEVVTTPGFKEAFAQYVSGGWQGLQHPADFGGQGLPKTIGAACGEMLNSANM
SFALCPLLSDGAIEALLTAGSDELKAVYLEKLVSGQWTGTMNLTEPQAGSDLAMVRSRAE
PQADGTYKVFGTKIFITYGEHDMAENIVHLVLARVTGAPEGVKGISLFVVPKFIVGKDGS
LGERNDVHCVSIEHKMGIKASPTAVLQYGDNGGAVGYLVGQENRGLEYMFIMMNSARYAV
GMQGIAIAERAYQHAVAYAKDRVQSRPVDGSINASAPIIHHPDVKRMLMTMRACTEGCRA
MASVAAAAYDAAHHHPDADARKQNQAFYEFMVPLVKGYSTEMSLEVTSLGVQVHGGMGFI
EETGAAQYYRDAKILTIYEGTTAIQANDLVGRKTARDGGQTAKAIAAQIEKTEGELAKHD
SAAAAAVRKRLKAAREAFVQVVDFVAGQTKASPNAVFAGSVPYLMLAGNLMAGWQLARSL
VIAEDLASRNVDTAFMQAKVATARFYAEHILNKVPGMRDSIVEGAESVTALPADMY