Protein Info for ABID97_RS28115 in Variovorax sp. OAS795

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 215 to 235 (21 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 327 to 351 (25 residues), see Phobius details amino acids 363 to 381 (19 residues), see Phobius details amino acids 393 to 411 (19 residues), see Phobius details PF07695: 7TMR-DISM_7TM" amino acids 217 to 410 (194 residues), 29.4 bits, see alignment E=7.6e-11 PF02518: HATPase_c" amino acids 557 to 646 (90 residues), 32 bits, see alignment E=1.5e-11

Best Hits

KEGG orthology group: None (inferred from 81% identity to vap:Vapar_6034)

Predicted SEED Role

"probable two-component sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (666 amino acids)

>ABID97_RS28115 ATP-binding protein (Variovorax sp. OAS795)
MTRGGKGRRLAGRWIAALWLALPLVALQVAHAHEPPAADEVQQGDSTLHIIHAELLSVAG
SGYSAPPRRAEDAKLPSDGWKTVGLPHTSGRELVPTSSAGVQTVTDWYRIDLAALAPSTR
PRFLYLPRWKTLGQIAVYGDGALLYHSHGSPVHNGYNRPLLLPLNATAHTLSPASVLIRV
DRLRSSGSGFSTVWVGDHWPLNWRYQVRQLLQVQLPFMGSAAFLAVGAFAFAVWLGRRRE
SLYLLFFAISATAFLRTLHYFVSGDNLPVPDDWFEWITVASLLWLIILIHLFLQHLHQQP
SRWLTRLSVALAAAGSISTLPQTSFASLYLVTPLLNLMVLPMAVLIFAVNLRKALRARLP
EGRLVAGWAVFALVFTSYDGLLQNNLVSPESVYTSPYAIISLFFVFSYIMFKHYTGAFAE
VGRLNMGLAERLQAREAELEQSYQRMRVIENEHMLGAERRRLMQDMHDGLGSSLISAIRS
VEQGTLSDAEITGVLKGCMDDLKLAIDSMESVDADLLLLLATLRFRLAPRIESAGLALRW
EVQSVPALPWLDPSSALHILRIMQEGVANVLRHTRATVICFSTAVEGQGVCVVIEDNGAG
FAVDEALRRSGRGLRNQQRRASAIGGVVSWESGSAGTRFKLWLPLYQGAVPGPVASEAVN
EKRPLG