Protein Info for ABID97_RS28080 in Variovorax sp. OAS795

Annotation: YbaN family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 45 (9 residues), see Phobius details amino acids 86 to 119 (34 residues), see Phobius details PF04304: DUF454" amino acids 9 to 123 (115 residues), 122.5 bits, see alignment E=4.7e-40

Best Hits

KEGG orthology group: K09790, hypothetical protein (inferred from 77% identity to vap:Vapar_6297)

Predicted SEED Role

"Hypothetical protein DUF454" in subsystem Heme, hemin uptake and utilization systems in GramPositives

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (124 amino acids)

>ABID97_RS28080 YbaN family protein (Variovorax sp. OAS795)
MRLPGPVAKLLWRVLALVLVGLGLLGAFLPLLPTVPFLLAAAWAAGHGWPALERWLLEHP
RYGGYVRRWREAGAVPRRAKWTASAMMLLSTVVLLVTAAPVAVKIGAPVFMAAVAVWLWR
RPEQ