Protein Info for ABID97_RS28030 in Variovorax sp. OAS795

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 61 to 86 (26 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 189 to 213 (25 residues), see Phobius details amino acids 220 to 249 (30 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 11 to 275 (265 residues), 120.8 bits, see alignment E=3e-39

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 72% identity to rec:RHECIAT_CH0002320)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>ABID97_RS28030 branched-chain amino acid ABC transporter permease (Variovorax sp. OAS795)
MSATLLAQSAIGGLLLGGIYGLLALGLSVSWGLLRLVNLSHFALAFLGAYLTYQLGTQFG
IAPWLSALVVVPAFFVAGIALHALFVRFQVSEFASMLVTFGITILIESLIQWLWSADYRK
FESGYAQSSLRIGPLFVPVLELAAFACAALLATAAWTGLNRTLLGKALRAAAHDGPIAAA
FGINAKRLSYLLAGLCAASAGVAGVFIALTSTLAPSQIEAWIGVVFAVVIIGGLARPLGA
LAAGCLIGVSESVTMAAVNPAWAPLVAFSILILLLLWRPRWL