Protein Info for ABID97_RS27940 in Variovorax sp. OAS795

Annotation: 2-keto-4-pentenoate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF01557: FAA_hydrolase" amino acids 76 to 258 (183 residues), 65.1 bits, see alignment E=3.8e-22

Best Hits

Swiss-Prot: 68% identical to MHPD3_PSEPU: 2-keto-4-pentenoate hydratase 3 (mhpD3) from Pseudomonas putida

KEGG orthology group: None (inferred from 71% identity to bug:BC1001_0833)

MetaCyc: 57% identical to 2-oxopent-4-enoate hydratase (Pseudomonas putida F1)
2-oxopent-4-enoate hydratase. [EC: 4.2.1.80]

Predicted SEED Role

"2-keto-4-pentenoate hydratase (EC 4.2.1.80)" (EC 4.2.1.80)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.80

Use Curated BLAST to search for 4.2.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>ABID97_RS27940 2-keto-4-pentenoate hydratase (Variovorax sp. OAS795)
MPSQSALLAEAADALWRAAGGHFIPPLRATYPGLDAADAYAIQRINTERKLAQGRRVVGC
KIGLTARAVQAQLGVDQPDFGVLFDDMSFGDAEPIPMRRLHQPKVEAEIAFVLGRDLAMG
NPGHADVIQAVDHVLPAIEVVGSRIAGWDIQFVDTVADNASSGAFVLGGSPRLLREIDLR
LCGMVMNRRGEPVSSGAGAACLGHPINAVAWLARTMAALGQPLRAGDLVLSGALGPMVAA
APGDVFETHINGLGSVKAVFEADAHPKELQ