Protein Info for ABID97_RS27575 in Variovorax sp. OAS795

Annotation: high-affinity branched-chain amino acid ABC transporter permease LivM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 151 to 168 (18 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 356 to 383 (28 residues), see Phobius details amino acids 395 to 413 (19 residues), see Phobius details PF11862: DUF3382" amino acids 17 to 111 (95 residues), 60 bits, see alignment E=2.3e-20 PF02653: BPD_transp_2" amino acids 122 to 406 (285 residues), 187.6 bits, see alignment E=2.6e-59

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 66% identity to tmz:Tmz1t_0567)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>ABID97_RS27575 high-affinity branched-chain amino acid ABC transporter permease LivM (Variovorax sp. OAS795)
MADPMAQDKGRHPLRWLADAALAALVAFLLGIPFIGLTTVDVGGRLAVQTRWSWLLATAG
LVFLGRLAVRWLFERQQVARGRSNRPSAMHRLGRANGSKLAGAFAIGVAVVLPFAFHDNR
YVVDTATTVLIYVMLGWGLNVVVGLAGLLDLGYVAFYAVGAYTYALLATQFGLSFWWCLP
IAGLFAAAFGVLLGYPTLRLRGDYLAIVTLGFGEIIRLVLLNWTDLTHGPDGIASIPRPT
LFGLSFAPPGNAATVAGTLGIEFAPWHRMVFLYLVILGLALLTNLLVLRLRRLPIGRAWE
AMREDEIACRALGINVTNVKLSAFALGAALGGVAGVFFAARQGFISPESFTFTESAIILA
IVVLGGSGSQFGVVLAACVLVLLPELGRNFSEYRMLLFGAAMVAIMVWRPGGLLSMRRAT
VNSAREERAAALREVGVPS