Protein Info for ABID97_RS27465 in Variovorax sp. OAS795

Annotation: malonate decarboxylase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 PF16957: Mal_decarbox_Al" amino acids 6 to 560 (555 residues), 969.7 bits, see alignment E=1.7e-296 TIGR01110: malonate decarboxylase, alpha subunit" amino acids 6 to 560 (555 residues), 940.8 bits, see alignment E=1.1e-287

Best Hits

KEGG orthology group: K13929, malonate decarboxylase alpha subunit [EC: 2.3.1.187] (inferred from 94% identity to vap:Vapar_5374)

Predicted SEED Role

"Malonate decarboxylase alpha subunit" in subsystem Malonate decarboxylase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.187

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (560 amino acids)

>ABID97_RS27465 malonate decarboxylase subunit alpha (Variovorax sp. OAS795)
MISTTWTSKADDRAARLARAAEALGKRLAGKRVETDAIATLLEAVLAPGDRVCLEGNNQK
QADFLAQALVQVDPAKVHGLHMVQSVLALPEHLDVFENGVAARLDFSFSGPQGARLAKLV
SAGRIEIGAIHTYLELFARYFVDLTPKVALVAAQAADAEGNLYTGPNTEDTPAIVEATAF
SGGIVIAQVNEMVDGKTTTLPRIDIPADWVSFVVKAPRPNFIEPLFTRDPAQISEVQILM
AMMAIKGIYAEYGVQRLNHGIGFDTAAIELLLPTYAESLGLKGKIGKHWALNPHPALIPA
IEAGWVESIHSFGSELGMEDYIRARSDVFFTGPDGSLRSNRAFCQAAGHYACDMFIGSTL
QIDLDGNSSTATLGRIAGFGGAPNMGADARGRRHASPAWLKAGREARAGRTGAAGTPRGQ
KLVVQMVETFREHMQPAFVDRLDAWTLQEQAGMDLPPIMIYGDDVSHILTEEGIANLLMC
RSDAEREQAIRGVAGYTAVGLARDRRAVENLRDRGVIRRPQDLGIDPRQATRNLLAARSM
RDLVRASGGLYQPPRRFRNW