Protein Info for ABID97_RS27455 in Variovorax sp. OAS795

Annotation: biotin-independent malonate decarboxylase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 TIGR03133: biotin-independent malonate decarboxylase, beta subunit" amino acids 3 to 270 (268 residues), 360.5 bits, see alignment E=2.7e-112 PF01039: Carboxyl_trans" amino acids 9 to 190 (182 residues), 67.7 bits, see alignment E=4.1e-23

Best Hits

KEGG orthology group: K13932, malonate decarboxylase beta subunit (inferred from 87% identity to vap:Vapar_5372)

Predicted SEED Role

"Malonate decarboxylase beta subunit" in subsystem Malonate decarboxylase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>ABID97_RS27455 biotin-independent malonate decarboxylase subunit beta (Variovorax sp. OAS795)
MISYAECSARERLALLLDPGSFHEWLPPSERVMSPHLAQLGVPSAFDDGVAVGRATLDGH
SVFVAAQEGAFMGGGVGEVHGAKLVGLMQRALRDRPAAVLLLAESGGVRLHEANAGLIAV
SEVMRALLDVRAAGIPVVVLIGGANGCFGGMGIVARCADHVVMSDVGRLAMSGPEVIEAS
HGVDEFDSRDRALVWRTTGGKHRWLIGDCDALVEDDVAAFRAAAIAAIGESKPFTLAALE
QEHALLTRRLHALDATDTTDLDEAVLLWSALGIADAQQVSELSVEAVRALRTI