Protein Info for ABID97_RS27415 in Variovorax sp. OAS795

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 17 to 167 (151 residues), 128.5 bits, E=2.8e-41

Best Hits

Swiss-Prot: 61% identical to GLUA_COREF: Glutamate transport ATP-binding protein GluA (gluA) from Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)

KEGG orthology group: K10041, putative glutamine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 97% identity to vap:Vapar_6371)

MetaCyc: 48% identical to L-arginine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"cell processes; transport of small molecules; amino acids, amines"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Protein Sequence (244 amino acids)

>ABID97_RS27415 amino acid ABC transporter ATP-binding protein (Variovorax sp. OAS795)
MILFSNINKWYGDYQALADVNAEVKKGEVVVVCGPSGSGKSTLIRTVNRLEEVKSGQLLF
DGHDIHAPMSSAALNKLRSRIGFVFQSFNLFPHLSVVENIMLSPMRVLGVKRAEAKERAA
QLLERVGLSNKAGAYPAQLSGGQQQRVAIARALAMEPPAMLFDEPTSALDPEMVGEVLSV
MRSLANDGMTMMCVTHEMNFARDVADRVWFMDAGRILEKADPEAFFGSPQHPRAQRFLSD
LRAH