Protein Info for ABID97_RS27370 in Variovorax sp. OAS795

Annotation: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 72 to 142 (71 residues), 66 bits, E=2.2e-22

Best Hits

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 82% identity to vap:Vapar_6362)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)
• 3-hydroxypropanoate cycle (8/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• glyoxylate assimilation (7/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (10/18 steps found)

Protein Sequence (144 amino acids)

>ABID97_RS27370 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit (Variovorax sp. OAS795)
MKQEQIKTLIDALAASDLAELEYTEDGSTLRLVKQSALKAVPMARPPAGARHATGAASAE
TALPEAAADECRAPLHGVVHLQPAPGEPPFVHPGQAVEAGQMLCVIEAMKMFNEVRAEVA
ATVQSVLVSSGQEVEAGEPLFRFG