Protein Info for ABID97_RS27100 in Variovorax sp. OAS795

Annotation: NO-inducible flavohemoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 PF00042: Globin" amino acids 26 to 130 (105 residues), 56.6 bits, see alignment E=5.3e-19 PF00970: FAD_binding_6" amino acids 158 to 251 (94 residues), 35.8 bits, see alignment E=1.3e-12 PF00175: NAD_binding_1" amino acids 267 to 369 (103 residues), 50.4 bits, see alignment E=4.9e-17

Best Hits

Swiss-Prot: 56% identical to HMP_BURST: Flavohemoprotein (hmp) from Burkholderia sp. (strain TH2)

KEGG orthology group: K05916, nitric oxide dioxygenase [EC: 1.14.12.17] (inferred from 90% identity to vap:Vapar_6324)

Predicted SEED Role

"Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17)" in subsystem Bacterial hemoglobins or Flavohaemoglobin or Glutaredoxins (EC 1.14.12.17)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>ABID97_RS27100 NO-inducible flavohemoprotein (Variovorax sp. OAS795)
MNPQTIAIVKATVPALQAHGEAITSHFYRIMFENHPEVKAFFNEAHQAAGSQARALAGAV
LAYATYIDRLEEIAGALPRIIQKHAALGVQPEHYPVVGACLLRAIKDVLGDAATDEIIAA
WGEAYQSLAALLIAAEEEVYRTNAAQPGGWRGEREFRVARREDESEVITSFYLEPTDGGP
LLAFSPGQYLTLVLEIDGEPLRRNYSLSDAPGKAWYRISVKKEEGGKASNWLHQAATVGT
LLKVQAPCGDFVLQPTATGKSARPLVLVTGGVGITPAMSMLESVAHTGRPVHFIHAARHG
GAHAFRARVDALAATHANVKPIYVYDAPRDADRPHATGFVTRELLAQQLPADRDVDLYFL
GPKPFMKSVYANGLALGVPKQQLRYEFFGPLEALEA