Protein Info for ABID97_RS27015 in Variovorax sp. OAS795

Annotation: DoxX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 99 to 125 (27 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details PF07681: DoxX" amino acids 40 to 127 (88 residues), 68.5 bits, see alignment E=6.7e-23

Best Hits

KEGG orthology group: None (inferred from 88% identity to vap:Vapar_6307)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>ABID97_RS27015 DoxX family protein (Variovorax sp. OAS795)
MSTPLQVPASIQGDPHHGLRARWNAVAERLTHLVAHDALALATRVGVAAIFFYSGRTKVQ
GFLTLTDSAYELFRTEYKLPLVPPEIAAHLAAYSEHLFPLLLVLGIFTRLSALALLGMTL
VIQVFVYPDAWPTHLSWAALLLYLVGRGGGRLSLDHALGIH