Protein Info for ABID97_RS26845 in Variovorax sp. OAS795

Annotation: carotenoid oxygenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF03055: RPE65" amino acids 16 to 473 (458 residues), 446.4 bits, see alignment E=7.9e-138

Best Hits

KEGG orthology group: K11159, carotenoid cleavage dioxygenase (inferred from 51% identity to pzu:PHZ_c0754)

Predicted SEED Role

"Lignostilbene-alpha,beta-dioxygenase and related enzymes" in subsystem Phenylpropanoid compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (476 amino acids)

>ABID97_RS26845 carotenoid oxygenase family protein (Variovorax sp. OAS795)
MNAETQTNPHFFTGNYAPLTEEHDIAALHIEGTLPPGLSGSLYRVGPSPQYAPRDNDYHW
FSGDGMVHAFHIDKGSVSYSNRWARTPKWQLEHEAGRALFGTFGNPATSDPLAQGRNGGT
ANTSMLWHGDRLFALEESHQPFELDAYTLASKGHQSFGDRVTSRSTAHPKVDPVSGELHF
FAYSPDGPCSPTMLYGVMDKHCEVTRLESFKAPYASMVHDFMVTREHVLFPVTPLTLSVE
RAMRGKPLLAWETGLRTCVGVMRRNGATDPLRWFDADACHVFHVMNAWDDGATVVAYVMQ
SETAPGLPDAEGHPGDPDAMAARLCRWTFDLSGTNTGFRREYLDDLVAEFPRIDERYAGR
RNRYGFYTCHATARARDDSESVLYDSLARFDFDTGERSMHTLPHGDVVSEPVFVPRATEA
AEGDGWLLAVAWREQERRSDLLVFDAMDLAAEPVAVARLPHRVPFGFHGTWRPARI