Protein Info for ABID97_RS26810 in Variovorax sp. OAS795

Annotation: DJ-1/PfpI family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 20 to 194 (175 residues), 75.4 bits, see alignment E=7.2e-25 PF12833: HTH_18" amino acids 258 to 337 (80 residues), 74.1 bits, see alignment E=1.4e-24

Best Hits

KEGG orthology group: None (inferred from 66% identity to gvi:gll1826)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>ABID97_RS26810 DJ-1/PfpI family protein (Variovorax sp. OAS795)
MTKIPEILPKQAARRQRPRRVLFVAFPEVGLLDLTGAQTVFWCATKAMEARGLAGYERVT
ASLEGGLVRSAEGLVLQTDALAGFRASSVDTLVVPGSPHMEQVLDNAAPLVKWLRRAAVK
TRRTASVCSGAFLLAAAGLLDHKRATTHWLMFDMMSLRFPSVQIDRDAIFVQQGAVWTSA
GVTAGIDLAMALVESDCGHEVAMEVARELVVYLKRPGGQSQFSKVLQAQAEDSAAMFDEL
NLWIAGNLERPNLGVERLAEQARMSPRNFARVYKQKTGLTPAKAVEVFRLEAAKRLLEDS
ARNVDQVAMLCGFGDEERMRVTFQRHLGVAPRDYRRRFAARRDSAA