Protein Info for ABID97_RS26760 in Variovorax sp. OAS795

Annotation: urea ABC transporter permease subunit UrtC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 310 to 334 (25 residues), see Phobius details TIGR03408: urea ABC transporter, permease protein UrtC" amino acids 26 to 333 (308 residues), 401.3 bits, see alignment E=2e-124 PF02653: BPD_transp_2" amino acids 32 to 323 (292 residues), 125.3 bits, see alignment E=1.3e-40

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 78% identity to axy:AXYL_00355)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtC" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>ABID97_RS26760 urea ABC transporter permease subunit UrtC (Variovorax sp. OAS795)
MKEILRSADTRGALLVLALLVAMVAVLDPFRLNLMGKYMSFAFVALGIVLLWGHGGVLSL
GQGLFFGAGGYMMAMFLKLEASAPELPDFMVWSSVEHLPLWWMPFRSLAPTLLLIVLLPP
VLAYLFAFAIFRKRVGGVYFAIVTLSLALTGTVLIVGQQGDTGGANGITDFRTLLGMDIV
GDDAKQAIYLVEAAALAMAMGLCLALLRSRFGKVLIAIRDKEDRVRFSGYDTAHMKAFVF
AVAALLSSIGGAFYSLQVGLISPTAVGVVASIEMVIYAAVGGRLSIPGAVIGALLVGFLK
SYLSETFPEVWLYFLGALFIAVVAFMPLGLAGVLQRLAAGRGAKGVSP