Protein Info for ABID97_RS26540 in Variovorax sp. OAS795

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 6 to 77 (72 residues), 64.3 bits, E=2.9e-21
• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 132 to 587 (456 residues), 460.7 bits, E=2.6e-142
• PF12831: FAD_oxidored
  • amino acids 133 to 170 (38 residues), 32.1 bits, 3.4e-11
• PF07992: Pyr_redox_2
  • amino acids 133 to 454 (322 residues), 192.3 bits, E=5.3e-60
• PF01134: GIDA
  • amino acids 134 to 201 (68 residues), 27.7 bits, E=5.8e-10
• PF00070: Pyr_redox
  • amino acids 302 to 372 (71 residues), 41.5 bits, E=6.5e-14
• PF02852: Pyr_redox_dim
  • amino acids 473 to 581 (109 residues), 114 bits, E=1.6e-36

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 92% identity to vap:Vapar_5336)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Protein Sequence (598 amino acids)

>ABID97_RS26540 dihydrolipoyl dehydrogenase (Variovorax sp. OAS795)
MAHTVEVKVPDIGEFKDVAVIELLVKPGEVIAVDTGLVMVESDKASMEIPSSHAGTVKEL
KVALGDKVSEGSVILVIETAAAASPLPPAGEGPGVRATAAPSPQPSPASGRGSEAAPTPV
AGSYTGKADLECEVLVLGAGPGGYSAAFRSADLGMKTMLVERYATLGGVCLNVGCIPSKA
LLHTAGVMDEVKLLAKHGIKFAAPEVDIDALRGFKDGVIKKLTGGLAGMAKARKVEVVTG
VGSFLDAYHVEVAGEGGAKKVVKFAKAIIAAGSQAVNLPFMPEDERVVDSTGALLLKGIP
KRMLVIGGGIIGLEMATVYSTLGTRIDVVEMLDGLMQGADRDLVKVWEKFNAPRFDNVML
KTKTIGAKATQAGIEVSFEGEKAPAGPQVYDLVLVAVGRSPNGKKIAADKAGVAVTDRGF
IDVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEAHVAAEAAHGEAAFFDARQIPSVAYTD
PEVAWAGKTEEQCKAEGLKIGKAVFPWAASGRAIANGRDEGFTKLLFDEATHRIVGGGIV
GTHAGDLISEVCLAIEMGCEPSDIGKTIHPHPTLGESIGMAAEVFEGHCTDLPPVKKK